What is the catalog number for BAS1 Recombinant Protein (Mouse-ear cress)?

The catalog number for BAS1 Recombinant Protein (Mouse-ear cress) is OPCA04522-100UG.

What sizes are available for BAS1 Recombinant Protein (Mouse-ear cress)?

BAS1 Recombinant Protein (Mouse-ear cress) is available in the following size(s): 100 µg.

Is BAS1 Recombinant Protein (Mouse-ear cress) in stock?

BAS1 Recombinant Protein (Mouse-ear cress) is currently made to order / not held in immediate stock. Contact us for lead time.

BAS1 Recombinant Protein (Mouse-ear cress)

Product Specifications

CAS Number

9000-83-3

Gene Name

Thioredoxin superfamily protein

Gene Aliases

AT3G11630; T19F11.3; Thiol-specific antioxidant protein A; Thioredoxin superfamily protein.

Gene ID

820335

Accession Number

NP_187769

Reactivity

Arabidopsis thaliana

Target

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf.

Type

Protein

Source

E.coli

Sequence

KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.