Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAS1 Recombinant Protein (Mouse-ear cress)

Product Specifications

CAS Number

9000-83-3

Gene Name

Thioredoxin superfamily protein

Gene Aliases

AT3G11630; T19F11.3; Thiol-specific antioxidant protein A; Thioredoxin superfamily protein.

Gene ID

820335

Accession Number

NP_187769

Reactivity

Arabidopsis thaliana

Target

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf.

Type

Protein

Source

E.coli

Sequence

KAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AT3G11630

Protein Name

2-Cys peroxiredoxin BAS1, chloroplastic

Gene Name URL

AT3G11630

Nucleotide Accession Number

NM_111995

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) ; Clone PMEL/783 (Concentrate)
RA0293-C.5 0.5 mL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) ; Clone PMEL/783 (Concentrate)

Sign In for Pricing
View Details
Recombinant Macrovipera lebetina C-type lectin A13
MBS1068712-01 0.02 mg (E-Coli)

Recombinant Macrovipera lebetina C-type lectin A13

Sign In for Pricing
View Details
Recombinant Macrovipera lebetina C-type lectin A13
MBS1068712-02 0.1 mg (E-Coli)

Recombinant Macrovipera lebetina C-type lectin A13

Sign In for Pricing
View Details
Recombinant Macrovipera lebetina C-type lectin A13
MBS1068712-03 0.02 mg (Yeast)

Recombinant Macrovipera lebetina C-type lectin A13

Sign In for Pricing
View Details
Recombinant Macrovipera lebetina C-type lectin A13
MBS1068712-04 0.1 mg (Yeast)

Recombinant Macrovipera lebetina C-type lectin A13

Sign In for Pricing
View Details
Recombinant Macrovipera lebetina C-type lectin A13
MBS1068712-05 0.02 mg (Baculovirus)

Recombinant Macrovipera lebetina C-type lectin A13

Sign In for Pricing
View Details