Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neutral phosphatase Recombinant Protein (Staphylococcus aureus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

NPTase

Reactivity

Staphylococcus aureus

Target

Highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae.

Type

Protein

Source

E.coli

Sequence

KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.7 kDa

Protein Length

Recombinant

Protein Name

30 kDa neutral phosphatase

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT14 Antibody
E306929b 200 µL

GALNT14 Antibody

Sign In for Pricing
View Details
Annexin A1 Antibody
V7838-100UG 100 µg

Annexin A1 Antibody

Sign In for Pricing
View Details
Sh3bgr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
43662114 3x 1.0 µg

Sh3bgr sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Prkcd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4993607 1.0 µg DNA

Prkcd sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Ethyl 1-boc-4-ethyl-4-piperidine carboxylate
448651-01 100 mg

Ethyl 1-boc-4-ethyl-4-piperidine carboxylate

Sign In for Pricing
View Details
Ethyl 1-boc-4-ethyl-4-piperidine carboxylate
448651-02 250 mg

Ethyl 1-boc-4-ethyl-4-piperidine carboxylate

Sign In for Pricing
View Details