Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neutral phosphatase Recombinant Protein (Staphylococcus aureus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

NPTase

Reactivity

Staphylococcus aureus

Target

Highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae.

Type

Protein

Source

E.coli

Sequence

KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.7 kDa

Protein Length

Recombinant

Protein Name

30 kDa neutral phosphatase

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX7 AAV Vector (Human) (CMV)
45580101 1 µg

SSX7 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Vmn1r202 Protein Lysate (Mouse) with C-HA Tag
49608034 100 µg

Vmn1r202 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
SP140 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
45158156 3x 1.0 µg DNA

SP140 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
LY2584702 tosylate
orb1227020-01 1 g

LY2584702 tosylate

Sign In for Pricing
View Details
LY2584702 tosylate
orb1227020-02 2 mg

LY2584702 tosylate

Sign In for Pricing
View Details
LY2584702 tosylate
orb1227020-03 5 mg

LY2584702 tosylate

Sign In for Pricing
View Details