Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LHB Recombinant Protein (Dog)

Product Specifications

CAS Number

9000-83-3

Gene Name

Luteinizing hormone subunit beta

Gene Aliases

LH; LH-B; LSH-B; LSH-beta; luteinizing hormone beta polypeptide; Luteinizing hormone subunit beta; lutropin beta chain; lutropin subunit beta.

Gene ID

403959

Reactivity

Canis lupus|Dog

Target

Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Type

Protein

Source

E.coli

Sequence

SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LHB

Protein Name

Lutropin subunit beta

Gene Name URL

LHB

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ZNF407 Antibody [Alexa Fluor 647]
NBP3-06058AF647 0.1 mL

Rabbit Polyclonal ZNF407 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
D130040H23Rik 3'UTR Luciferase Stable Cell Line
TU104758 1.0 mL

D130040H23Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human E2F1 Pre-designed siRNA Set A
SI004681A 1 Each

Human E2F1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CANX | Calnexin Mouse mAb
orb3126794-01 50 µL

CANX | Calnexin Mouse mAb

Sign In for Pricing
View Details
CANX | Calnexin Mouse mAb
orb3126794-02 100 µL

CANX | Calnexin Mouse mAb

Sign In for Pricing
View Details
CANX | Calnexin Mouse mAb
orb3126794-03 200 µL

CANX | Calnexin Mouse mAb

Sign In for Pricing
View Details