LHB Recombinant Protein (Dog)
Product Specifications
CAS Number
9000-83-3
Gene Name
Luteinizing hormone subunit beta
Gene Aliases
LH; LH-B; LSH-B; LSH-beta; luteinizing hormone beta polypeptide; Luteinizing hormone subunit beta; lutropin beta chain; lutropin subunit beta.
Gene ID
403959
Reactivity
Canis lupus|Dog
Target
Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.
Type
Protein
Source
E.coli
Sequence
SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
16.8 kDa
Protein Length
Recombinant
NCBI Gene Symbol
LHB
Protein Name
Lutropin subunit beta
Gene Name URL
LHB
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6178174-01 0.1 mL
ISCU (Iron-sulfur cluster scaffold Homolog (E. coli), 2310020H20Rik, HML, ISU2, MGC74517, NIFU, NIFUN, hnifU) (FITC)
Sign In for Pricing
View Details MBS6178174-02 5x 0.1 mL
ISCU (Iron-sulfur cluster scaffold Homolog (E. coli), 2310020H20Rik, HML, ISU2, MGC74517, NIFU, NIFUN, hnifU) (FITC)
Sign In for Pricing
View Details LV651901 1.0 µg DNA
TMX1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
MBS6483740-01 0.1 mL
JIK, CT (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Se
Sign In for Pricing
View Details MBS6483740-02 5x 0.1 mL
JIK, CT (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Se
Sign In for Pricing
View Details