Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LHB Recombinant Protein (Dog)

Product Specifications

CAS Number

9000-83-3

Gene Name

Luteinizing hormone subunit beta

Gene Aliases

LH; LH-B; LSH-B; LSH-beta; luteinizing hormone beta polypeptide; Luteinizing hormone subunit beta; lutropin beta chain; lutropin subunit beta.

Gene ID

403959

Reactivity

Canis lupus|Dog

Target

Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Type

Protein

Source

E.coli

Sequence

SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LHB

Protein Name

Lutropin subunit beta

Gene Name URL

LHB

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fit 10ml Thermo pipette, clear, sterile, rack pack
PT-10000R-T 24 PCS/Rack - 40 Racks/Case

Fit 10ml Thermo pipette, clear, sterile, rack pack

Sign In for Pricing
View Details
NPM1 Antibody
orb607572-01 20 µg

NPM1 Antibody

Sign In for Pricing
View Details
NPM1 Antibody
orb607572-02 100 µg

NPM1 Antibody

Sign In for Pricing
View Details
NPM1 Antibody
orb607572-03 100 ug (without BSA and Azide)

NPM1 Antibody

Sign In for Pricing
View Details
Dab2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6938005 3x 1.0 µg

Dab2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
TREX1 siRNA (Mouse)
MBS8217286-01 15 nmol

TREX1 siRNA (Mouse)

Sign In for Pricing
View Details