LGALS9 Recombinant Protein (Human)
Product Specifications
CAS Number
9000-83-3
Gene Name
Galectin 9
Gene Aliases
Ecalectin; gal-9; galectin-9; HUAT; lectin, galactoside-binding, soluble, 9; LGALS9A; tumor antigen HOM-HD-21; urate transporter/channel protein.
Gene ID
3965
Accession Number
NP_001317092
Reactivity
Homo sapiens|Human
Target
Binds galactosides (PubMed:18005988) . Has high affinity for the Forssman pentasaccharide (PubMed:18005988) . Ligand for HAVCR2/TIM3 (PubMed:16286920) . Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (PubMed:16286920) . Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth (By similarity) . Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration (PubMed:21670307) . Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (By similarity) . Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation (PubMed:23817958) . Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection (PubMed:20209097) . Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells (PubMed:24465902, PubMed:16116184) . Inhibits degranulation and induces apoptosis of mast cells (PubMed:24465902) . Induces maturation and migration of dendritic cells (PubMed:25754930, PubMed:16116184) . Inhibits natural killer (NK) cell function (PubMed:23408620) . Can transform NK cell phenotype from peripheral to decidual during pregnancy (PubMed:25578313) . Astrocyte derived galectin-9 enhances microglial TNF production (By similarity) . May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion (By similarity) . Highly selective to the anion urate (By similarity) .
Type
Protein
Source
Yeast
Sequence
MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
37.7 kDa
Protein Length
Recombinant
NCBI Gene Symbol
LGALS9
Protein Name
Galectin-9
Gene Name URL
LGALS9
Nucleotide Accession Number
NM_001330163
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog