Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aspergillopepsin-2?partial Recombinant Protein (Aspergillus niger)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Acid protease A; Aspergillopepsin II; Proctase A.

Reactivity

Aspergillus niger

Type

Protein

Source

E.coli

Sequence

EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.9 kDa

Protein Length

Recombinant

Protein Name

Aspergillopepsin-2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GGP3 Polyclonal Antibody
MBS7144764 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) GGP3 Polyclonal Antibody

Sign In for Pricing
View Details
Commd8 3'UTR GFP Stable Cell Line
TU252650 1.0 mL

Commd8 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human RHBDD3 shRNA (UAS) - Lentiviral human RHBDD3 shRNA (UAS) (100)
GTR15145446 1 Vial

Lentiviral human RHBDD3 shRNA (UAS) - Lentiviral human RHBDD3 shRNA (UAS) (100)

Sign In for Pricing
View Details
C3orf17 (NEPRO) Human qPCR Template Standard (NM_015412)
HK201454 1 Kit

C3orf17 (NEPRO) Human qPCR Template Standard (NM_015412)

Sign In for Pricing
View Details
Recombinant Bordetella Bronchiseptica phnC Protein (aa 1-256)
VAng-Lsx4277-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Bronchiseptica phnC Protein (aa 1-256)

Sign In for Pricing
View Details
Lentiviral mouse B4gat1 shRNA (UAS) - Lentiviral mouse B4gat1 shRNA (UAS, RFP) (25)
GTR15175859 1 Vial

Lentiviral mouse B4gat1 shRNA (UAS) - Lentiviral mouse B4gat1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details