Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aspergillopepsin-2?partial Recombinant Protein (Aspergillus niger)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Acid protease A; Aspergillopepsin II; Proctase A.

Reactivity

Aspergillus niger

Type

Protein

Source

E.coli

Sequence

EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.9 kDa

Protein Length

Recombinant

Protein Name

Aspergillopepsin-2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal pan Cadherin Antibody (OTI4F1) [DyLight 550]
NBP2-73237R 0.1 mL

Mouse Monoclonal pan Cadherin Antibody (OTI4F1) [DyLight 550]

Sign In for Pricing
View Details
Tryptase Alpha / Beta-1 (TPSAB1) Antibody
abx100214-01 100 µL

Tryptase Alpha / Beta-1 (TPSAB1) Antibody

Sign In for Pricing
View Details
Tryptase Alpha / Beta-1 (TPSAB1) Antibody
abx100214-02 200 µL

Tryptase Alpha / Beta-1 (TPSAB1) Antibody

Sign In for Pricing
View Details
Tryptase Alpha / Beta-1 (TPSAB1) Antibody
abx100214-03 1 mL

Tryptase Alpha / Beta-1 (TPSAB1) Antibody

Sign In for Pricing
View Details
FBXO8 Lentiviral Activation Particles (h)
sc-406863-LAC 200 µL

FBXO8 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
FibuLin 5 (FBLN5) (NM_006329) Human Recombinant Protein
TP304683L 1 mg

FibuLin 5 (FBLN5) (NM_006329) Human Recombinant Protein

Sign In for Pricing
View Details