Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMCA Recombinant Protein (Chlamydia trachomatis)

Product Specifications

CAS Number

9000-83-3

Gene Name

Lipoprotein OmcA

Gene Aliases

9 kDa cysteine-rich lipoprotein; CT_444.

Gene ID

884216

Accession Number

NP_219956

Reactivity

Chlamydia trachomatis

Target

In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity) .

Type

Protein

Source

E.coli

Sequence

CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

OmcA

Protein Name

Small cysteine-rich outer membrane protein OmcA

Gene Name URL

OmcA

Nucleotide Accession Number

NC_000117

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti-GNB3 Antibody
MBS421000-01 0.1 mg

Goat anti-GNB3 Antibody

Sign In for Pricing
View Details
Goat anti-GNB3 Antibody
MBS421000-02 5x 0.1 mg

Goat anti-GNB3 Antibody

Sign In for Pricing
View Details
PTPε siRNA (h)
sc-44054 10 µM

PTPε siRNA (h)

Sign In for Pricing
View Details
Mouse Adenylate Cyclase 7 (ADCY7) Antibody Pair Kit (with Standard)
MBS2100353-01 5x 96 Tests

Mouse Adenylate Cyclase 7 (ADCY7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Adenylate Cyclase 7 (ADCY7) Antibody Pair Kit (with Standard)
MBS2100353-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Adenylate Cyclase 7 (ADCY7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Adenylate Cyclase 7 (ADCY7) Antibody Pair Kit (with Standard)
MBS2100353-03 10x 96 Tests

Mouse Adenylate Cyclase 7 (ADCY7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details