Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QPCT Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutaminyl-peptide cyclotransferase (glutaminyl cyclase)

Gene Aliases

5730422A13Rik; glutaminyl cyclase; glutaminyl-peptide cyclotransferase; glutaminyl-tRNA cyclotransferase; QC.

Gene ID

70536

Accession Number

NP_001303658

Reactivity

Mouse|Mus musculus

Target

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity) .

Type

Protein

Source

E.coli

Sequence

AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Qpct

Protein Name

Glutaminyl-peptide cyclotransferase

Gene Name URL

Qpct

Nucleotide Accession Number

NM_001316729

More Discoveries

Explore Other Products

Browse additional items from our catalog

Poly (D, L-lactic acid), IV 0.4 dL/g, acid terminated
50050-25 25 g

Poly (D, L-lactic acid), IV 0.4 dL/g, acid terminated

Sign In for Pricing
View Details
Mouse Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit
MBS9918726-01 48 Well

Mouse Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit

Sign In for Pricing
View Details
Mouse Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit
MBS9918726-02 96 Well

Mouse Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit

Sign In for Pricing
View Details
Mouse Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit
MBS9918726-03 5x 96 Well

Mouse Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit

Sign In for Pricing
View Details
Mouse Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit
MBS9918726-04 10x 96 Well

Mouse Uncharacterized Protein C22orf25 (C22ORF25) ELISA Kit

Sign In for Pricing
View Details
SLAMF7 Antibody
15-396 100 µL

SLAMF7 Antibody

Sign In for Pricing
View Details