Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclomaltodextrin glucanotransferase, partial Recombinant Protein (Bacillus macerans)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cyclodextrin-glycosyltransferase.

Reactivity

Paenibacillus macerans

Type

Protein

Source

Yeast

Sequence

VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.4 kDa

Protein Length

Recombinant

Protein Name

Cyclomaltodextrin glucanotransferase

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat rno-miR-501-5p miRNA Agomir
abx884678-01 5 nmol

Rat rno-miR-501-5p miRNA Agomir

Sign In for Pricing
View Details
Rat rno-miR-501-5p miRNA Agomir
abx884678-02 10 nmol

Rat rno-miR-501-5p miRNA Agomir

Sign In for Pricing
View Details
Mouse anti-Human CD86, Purified mAb
E16HU086-500 500 Tests

Mouse anti-Human CD86, Purified mAb

Sign In for Pricing
View Details
SH3BP2 Protein Vector (Mouse) (pPM-C-HA)
PV228824 500 ng

SH3BP2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Vmn2r13 3'UTR Luciferase Stable Cell Line
TU122012 1.0 mL

Vmn2r13 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GluR4 Polyclonal Antibody
ABP54639-01 30 µL

GluR4 Polyclonal Antibody

Sign In for Pricing
View Details