Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclomaltodextrin glucanotransferase, partial Recombinant Protein (Bacillus macerans)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cyclodextrin-glycosyltransferase.

Reactivity

Paenibacillus macerans

Type

Protein

Source

Yeast

Sequence

VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.4 kDa

Protein Length

Recombinant

Protein Name

Cyclomaltodextrin glucanotransferase

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP2 (Forkhead Box P2, Forkhead Box Protein P2, CAG Repeat Protein 44, CAGH44, SPCH1, Trinucleotide Repeat-containing Gene 10 Protein, TNRC10)
F9050-02H 100 µg

FOXP2 (Forkhead Box P2, Forkhead Box Protein P2, CAG Repeat Protein 44, CAGH44, SPCH1, Trinucleotide Repeat-containing Gene 10 Protein, TNRC10)

Sign In for Pricing
View Details
Mouse Monoclonal NF-L Antibody (SPM204) [Alexa Fluor 488]
NBP3-11576AF488 0.1 mL

Mouse Monoclonal NF-L Antibody (SPM204) [Alexa Fluor 488]

Sign In for Pricing
View Details
Fmoc-Abu-SASRIN resin (200-400 mesh, 0.5-0.8 mmol/g)
D-1825.0001 1.0g

Fmoc-Abu-SASRIN resin (200-400 mesh, 0.5-0.8 mmol/g)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Bud site selection protein 9 (BUD9) , partial
MBS7061372 Inquire

Recombinant Saccharomyces cerevisiae Bud site selection protein 9 (BUD9) , partial

Sign In for Pricing
View Details
Art5 Mouse shRNA Plasmid (Locus ID 11875)
TL516229 1 Kit

Art5 Mouse shRNA Plasmid (Locus ID 11875)

Sign In for Pricing
View Details
Mouse Monoclonal Angiopoietin-1 Antibody (OTI8H2) [FITC]
NBP2-70172F 0.1 mL

Mouse Monoclonal Angiopoietin-1 Antibody (OTI8H2) [FITC]

Sign In for Pricing
View Details