Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclomaltodextrin glucanotransferase, partial Recombinant Protein (Bacillus macerans)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cyclodextrin-glycosyltransferase.

Reactivity

Paenibacillus macerans

Type

Protein

Source

Yeast

Sequence

VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.4 kDa

Protein Length

Recombinant

Protein Name

Cyclomaltodextrin glucanotransferase

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau Peptide (307-321)
4099426.1 1 mg

Tau Peptide (307-321)

Sign In for Pricing
View Details
Donkey NADPH Oxidase 3 (NOX3) ELISA Kit
MBS9362643 Inquire

Donkey NADPH Oxidase 3 (NOX3) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) LECRKS5 Polyclonal Antibody
MBS9012533 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) LECRKS5 Polyclonal Antibody

Sign In for Pricing
View Details
ORC4 Antibody
orb790820 2 mg

ORC4 Antibody

Sign In for Pricing
View Details
Rabbit anti-Human immunodeficiency virus type 1 group M subtype B (isolate MN)(HIV-1) VPU Polyclonal Antibody
MBS7162181 Inquire

Rabbit anti-Human immunodeficiency virus type 1 group M subtype B (isolate MN)(HIV-1) VPU Polyclonal Antibody

Sign In for Pricing
View Details
ZBED3 (NM_032367) Human Tagged ORF Clone Lentiviral Particle
RC203522L4V 200 µL

ZBED3 (NM_032367) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details