Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT7 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Keratin 7

Gene Aliases

CK7; CK-7; cytokeratin 7; Cytokeratin-7; K2C7; K7; keratin 7, type II; keratin, 55K type II cytoskeletal; keratin, simple epithelial type I, K7; keratin, type II cytoskeletal 7; Keratin-7; sarcolectin; SCL; type II mesothelial keratin K7; type-II keratin Kb7.

Gene ID

3855

Accession Number

NP_005547

Reactivity

Homo sapiens|Human

Target

Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7) .

Type

Protein

Source

E.coli

Sequence

SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

67.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

KRT7

Protein Name

Keratin, type II cytoskeletal 7

Gene Name URL

KRT7

Nucleotide Accession Number

NM_005556

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta tubulin cofactor D Rabbit pAb, IRDye 800CW conjugated
orb2819642 100 µL

Beta tubulin cofactor D Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Anti-ZNF187  (1D9)
YF-MA16191 200 ul

Anti-ZNF187 (1D9)

Sign In for Pricing
View Details
Anti-Human CD140a/PDGFRA Antibody (SAA0056), PE
MBS1583424-01 50 Tests

Anti-Human CD140a/PDGFRA Antibody (SAA0056), PE

Sign In for Pricing
View Details
Anti-Human CD140a/PDGFRA Antibody (SAA0056), PE
MBS1583424-02 100 Tests

Anti-Human CD140a/PDGFRA Antibody (SAA0056), PE

Sign In for Pricing
View Details
Anti-Human CD140a/PDGFRA Antibody (SAA0056), PE
MBS1583424-03 5x 100 Tests

Anti-Human CD140a/PDGFRA Antibody (SAA0056), PE

Sign In for Pricing
View Details
HVEM/TNFRSF14, Human (HEK293, mFc)
HY-P704665 100 µg

HVEM/TNFRSF14, Human (HEK293, mFc)

Sign In for Pricing
View Details