Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRH1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Histamine receptor H1

Gene Aliases

H1R; H1-R; HH1R; hisH1; histamine H1 receptor; histamine receptor, subclass H1.

Gene ID

3269

Accession Number

NP_000852

Reactivity

Homo sapiens|Human

Target

In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system.

Type

Protein

Source

E.coli

Sequence

AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HRH1

Protein Name

Histamine H1 receptor

Gene Name URL

HRH1

Nucleotide Accession Number

NM_000861

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Non-sterile PP Syringe Filters, 5.0 (μm), 4 (mm), 100pcs/pk
11084104 100 PCS

Non-sterile PP Syringe Filters, 5.0 (μm), 4 (mm), 100pcs/pk

Sign In for Pricing
View Details
SYNE2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2320507 1.0 µg DNA

SYNE2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human CCAAT/Enhancer binding protein Alpha ELISA Kit
MBS726010-01 48 Well

Human CCAAT/Enhancer binding protein Alpha ELISA Kit

Sign In for Pricing
View Details
Human CCAAT/Enhancer binding protein Alpha ELISA Kit
MBS726010-02 96 Well

Human CCAAT/Enhancer binding protein Alpha ELISA Kit

Sign In for Pricing
View Details
Human CCAAT/Enhancer binding protein Alpha ELISA Kit
MBS726010-03 5x 96 Well

Human CCAAT/Enhancer binding protein Alpha ELISA Kit

Sign In for Pricing
View Details
Human CCAAT/Enhancer binding protein Alpha ELISA Kit
MBS726010-04 10x 96 Well

Human CCAAT/Enhancer binding protein Alpha ELISA Kit

Sign In for Pricing
View Details