Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM7 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

CEA cell adhesion molecule 7

Gene Aliases

Carcinoembryonic antigen CGM2; carcinoembryonic antigen gene family member 2; carcinoembryonic antigen related cell adhesion molecule 7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2.

Gene ID

1087

Accession Number

NP_001278414

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CEACAM7

Protein Name

Carcinoembryonic antigen-related cell adhesion molecule 7

Gene Name URL

CEACAM7

Nucleotide Accession Number

NM_001291485

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Mitochondrial uncoupling protein 2 ELISA Kit
MBS2887388-01 48 Well

Rat Mitochondrial uncoupling protein 2 ELISA Kit

Sign In for Pricing
View Details
Rat Mitochondrial uncoupling protein 2 ELISA Kit
MBS2887388-02 96 Well

Rat Mitochondrial uncoupling protein 2 ELISA Kit

Sign In for Pricing
View Details
Rat Mitochondrial uncoupling protein 2 ELISA Kit
MBS2887388-03 5x 96 Well

Rat Mitochondrial uncoupling protein 2 ELISA Kit

Sign In for Pricing
View Details
Rat Mitochondrial uncoupling protein 2 ELISA Kit
MBS2887388-04 10x 96 Well

Rat Mitochondrial uncoupling protein 2 ELISA Kit

Sign In for Pricing
View Details
Bovine IFNb ELISA Kit
orb437058-01 48 Tests

Bovine IFNb ELISA Kit

Sign In for Pricing
View Details
Bovine IFNb ELISA Kit
orb437058-02 96 Tests

Bovine IFNb ELISA Kit

Sign In for Pricing
View Details