Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyclomaltodextrin glucanotransferase, partial Recombinant Protein (Bacillus macerans)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cyclodextrin-glycosyltransferase.

Reactivity

Paenibacillus macerans

Type

Protein

Source

E.coli

Sequence

VLTADQVTVRFKVNNATTALGQNVYLTGNVAELGNWTAANAIGPMYNQVEASYPTWYFDVSVPANTALQFKFIKVNGSTVTWEGGNNHTFTSPSSGVATVTVDWQN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

15.4 kDa

Protein Length

Recombinant

Protein Name

Cyclomaltodextrin glucanotransferase

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF8 shRNA Plasmid
abx955163-01 150 µg

Human ZNF8 shRNA Plasmid

Sign In for Pricing
View Details
Human ZNF8 shRNA Plasmid
abx955163-02 300 µg

Human ZNF8 shRNA Plasmid

Sign In for Pricing
View Details
Culture Medium for Immortalized Human Osteoblast Cells
AFG-ELL-2985-01 100 mL

Culture Medium for Immortalized Human Osteoblast Cells

Sign In for Pricing
View Details
Culture Medium for Immortalized Human Osteoblast Cells
AFG-ELL-2985-02 500 mL

Culture Medium for Immortalized Human Osteoblast Cells

Sign In for Pricing
View Details
Recombinant Human DOK7 Protein, N-His
orb3153901-01 50 µg

Recombinant Human DOK7 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DOK7 Protein, N-His
orb3153901-02 100 µg

Recombinant Human DOK7 Protein, N-His

Sign In for Pricing
View Details