Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNS Recombinant Protein (Serratia marcescens)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Histone-like protein HLP-II.

Reactivity

Serratia marcescens

Target

A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins (By similarity) .

Type

Protein

Source

Yeast

Sequence

SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HNS

Protein Name

DNA-binding protein H-NS

Gene Name URL

HNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Luciferase Expressing Monkey Primary Small Intestinal Microvascular Endothelial Cells
NHFF-1123-HX336 Each

Luciferase Expressing Monkey Primary Small Intestinal Microvascular Endothelial Cells

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)
MBS2130318-01 0.1 mL

Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)
MBS2130318-02 0.2 mL

Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)
MBS2130318-03 0.5 mL

Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)
MBS2130318-04 1 mL

Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)
MBS2130318-05 5 mL

Biotin Linked Monoclonal Antibody to Aquaporin 4 (AQP4)

Sign In for Pricing
View Details