Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HFB1 Recombinant Protein (Trichoderma reesei)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Hydrophobin I.

Reactivity

Hypocrea jecorina|Trichoderma reesei

Target

Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Type

Protein

Source

E.coli

Sequence

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HFB1

Protein Name

Hydrophobin-1

Gene Name URL

HFB1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal PTH Antibody (PTH/1717R) [DyLight 550]
NBP2-54474R 100 µL

Rabbit Monoclonal PTH Antibody (PTH/1717R) [DyLight 550]

Sign In for Pricing
View Details
SNX8 Adenovirus (Rat)
45089056 1.0 mL

SNX8 Adenovirus (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Ufm1 shRNA (UAS) - Lentiviral mouse Ufm1 shRNA (UAS, GFP) (100)
GTR15242157 1 Vial

Lentiviral mouse Ufm1 shRNA (UAS) - Lentiviral mouse Ufm1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
PHF5A Antibody
A31134-50UG 50 µg

PHF5A Antibody

Sign In for Pricing
View Details
p70 S6 kinase α Lentiviral Activation Particles (h)
sc-400162-LAC 200 µL

p70 S6 kinase α Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
TM16A Antibody
E11-11202C 100 µg

TM16A Antibody

Sign In for Pricing
View Details