Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HFB1 Recombinant Protein (Trichoderma reesei)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Hydrophobin I.

Reactivity

Hypocrea jecorina|Trichoderma reesei

Target

Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Type

Protein

Source

E.coli

Sequence

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HFB1

Protein Name

Hydrophobin-1

Gene Name URL

HFB1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Efcc1 (NM_001159697) Mouse Tagged Lenti ORF Clone
MR222441L3 10 µg

Efcc1 (NM_001159697) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PMP2 Polyclonal Antibody, APC Conjugated
bs-2032R-APC 100 µL

PMP2 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
CXCL1 Recombinant Protein
91-628 0.05 mg

CXCL1 Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human CGRRF1 shRNA (UAS) - Lentiviral human CGRRF1 shRNA (UAS, GFP) plasmid
GTR15084658 1 Vial

Lentiviral human CGRRF1 shRNA (UAS) - Lentiviral human CGRRF1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae aroK Protein (aa 1-180) (strain 86-028NP)
VAng-Lsx03082-500gEcoli 500 µg (E. coli)

Recombinant Haemophilus Influenzae aroK Protein (aa 1-180) (strain 86-028NP)

Sign In for Pricing
View Details
SDCCAG33, ID (Teashirt Homolog 1, Serologically Defined Colon Cancer Antigen 33, Antigen NY-CO-33, TSH1, TSHZ1) (MaxLight 490)
MBS6498654-01 0.1 mL

SDCCAG33, ID (Teashirt Homolog 1, Serologically Defined Colon Cancer Antigen 33, Antigen NY-CO-33, TSH1, TSHZ1) (MaxLight 490)

Sign In for Pricing
View Details