Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HFB1 Recombinant Protein (Trichoderma reesei)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Hydrophobin I.

Reactivity

Hypocrea jecorina|Trichoderma reesei

Target

Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Type

Protein

Source

E.coli

Sequence

SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HFB1

Protein Name

Hydrophobin-1

Gene Name URL

HFB1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) Magnetic Fluorescence Assay Kit
MBS2154918-01 96 Tests

Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) Magnetic Fluorescence Assay Kit
MBS2154918-02 5x 96 Tests

Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) Magnetic Fluorescence Assay Kit
MBS2154918-03 10x 96 Tests

Tissue Inhibitors Of Metalloproteinase 3 (TIMP3) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
SCARB1 Protein (C-His, Mouse)
P528262 100 µg

SCARB1 Protein (C-His, Mouse)

Sign In for Pricing
View Details
Bovine Endothelin 1 Antibody ELISA Kit
MBS035245-01 48 Well

Bovine Endothelin 1 Antibody ELISA Kit

Sign In for Pricing
View Details
Bovine Endothelin 1 Antibody ELISA Kit
MBS035245-02 96 Well

Bovine Endothelin 1 Antibody ELISA Kit

Sign In for Pricing
View Details