Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPS Recombinant Protein (Campylobacter pylori)

Product Specifications

CAS Number

9000-83-3

Gene Name

DNA starvation/stationary phase protection protein

Gene Aliases

Bacterioferritin; DNA starvation/stationary phase protection protein; HP_0243; HP_RS01195; HP0243; HP-NAP; Neutrophil-activating protein A.

Gene ID

898765

Reactivity

Helicobacter pylori

Target

Protects DNA from oxidative damage by sequestering intracellular Fe (2+) ion and storing it in the form of Fe (3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe (2+) ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity) . Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.

Type

Protein

Source

E.coli

Sequence

MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HP_RS01195

Protein Name

DNA protection during starvation protein

Gene Name URL

HP_RS01195

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rel- (1R,3r,5S) -3-Hydroxyspiro[bicyclo[3.2.1]octane-8,1'-pyrrolidin]-8-ium chloride
OR1047539-01 100 mg

Rel- (1R,3r,5S) -3-Hydroxyspiro[bicyclo[3.2.1]octane-8,1'-pyrrolidin]-8-ium chloride

Sign In for Pricing
View Details
Rel- (1R,3r,5S) -3-Hydroxyspiro[bicyclo[3.2.1]octane-8,1'-pyrrolidin]-8-ium chloride
OR1047539-02 250 mg

Rel- (1R,3r,5S) -3-Hydroxyspiro[bicyclo[3.2.1]octane-8,1'-pyrrolidin]-8-ium chloride

Sign In for Pricing
View Details
Rel- (1R,3r,5S) -3-Hydroxyspiro[bicyclo[3.2.1]octane-8,1'-pyrrolidin]-8-ium chloride
OR1047539-03 1 g

Rel- (1R,3r,5S) -3-Hydroxyspiro[bicyclo[3.2.1]octane-8,1'-pyrrolidin]-8-ium chloride

Sign In for Pricing
View Details
LMOD3 3'UTR Luciferase Stable Cell Line
TU012540 1.0 mL

LMOD3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mycobacterium Tuberculosis gcvT Protein (aa 1-367)
VAng-Yyj0055-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Tuberculosis gcvT Protein (aa 1-367)

Sign In for Pricing
View Details
Human IQCA1 Knockout HEK293T cell line
GTR15419935 1 Vial

Human IQCA1 Knockout HEK293T cell line

Sign In for Pricing
View Details