Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPS Recombinant Protein (Campylobacter pylori)

Product Specifications

CAS Number

9000-83-3

Gene Name

DNA starvation/stationary phase protection protein

Gene Aliases

Bacterioferritin; DNA starvation/stationary phase protection protein; HP_0243; HP_RS01195; HP0243; HP-NAP; Neutrophil-activating protein A.

Gene ID

898765

Reactivity

Helicobacter pylori

Target

Protects DNA from oxidative damage by sequestering intracellular Fe (2+) ion and storing it in the form of Fe (3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe (2+) ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity) . Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.

Type

Protein

Source

E.coli

Sequence

MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HP_RS01195

Protein Name

DNA protection during starvation protein

Gene Name URL

HP_RS01195

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Os9 (NM_177614) Mouse Recombinant Protein
TP509456 20 µg

Os9 (NM_177614) Mouse Recombinant Protein

Ask
View Details
JMJD2B, phosphorylated (S566) (KDM4B, JHDM3B, JMJD2B, KIAA0876, Lysine-specific demethylase 4B, JmjC domain-containing histone demethylation protein 3B, Jumonji domain-containing protein 2B) (APC) discontinued
037202-APC 200 µL

JMJD2B, phosphorylated (S566) (KDM4B, JHDM3B, JMJD2B, KIAA0876, Lysine-specific demethylase 4B, JmjC domain-containing histone demethylation protein 3B, Jumonji domain-containing protein 2B) (APC) discontinued

Ask
View Details
Recombinant Human PTHLH Protein, no tag
HY340022-01 50 µg

Recombinant Human PTHLH Protein, no tag

Ask
View Details
Recombinant Human PTHLH Protein, no tag
HY340022-02 100 µg

Recombinant Human PTHLH Protein, no tag

Ask
View Details
Recombinant Human PTHLH Protein, no tag
HY340022-03 1 mg

Recombinant Human PTHLH Protein, no tag

Ask
View Details
RNF14 Antibody
E38QA7462 100 µL

RNF14 Antibody

Ask
View Details