What is the catalog number for OMP Recombinant Protein (Rickettsia japonica)?

The catalog number for OMP Recombinant Protein (Rickettsia japonica) is OPCA04446-100UG.

What sizes are available for OMP Recombinant Protein (Rickettsia japonica)?

OMP Recombinant Protein (Rickettsia japonica) is available in the following size(s): 100 µg.

Is OMP Recombinant Protein (Rickettsia japonica) in stock?

OMP Recombinant Protein (Rickettsia japonica) is currently made to order / not held in immediate stock. Contact us for lead time.

OMP Recombinant Protein (Rickettsia japonica)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Omp, RJP_094417 kDa surface antigen

Reactivity

Rickettsia japonica

Type

Protein

Source

E.coli

Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.