Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Invasin Recombinant Protein (Yersinia enterocolitica)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Invasin

Reactivity

Yersinia enterocolitica|Yersinia enterolitica

Target

Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins.

Type

Protein

Source

E.coli

Sequence

VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.3 kDa

Protein Length

Recombinant

Protein Name

Invasin

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-STC1 Polyclonal Antibody
PAV3850 100 μL

Rabbit Anti-STC1 Polyclonal Antibody

Sign In for Pricing
View Details
Human SCNN1B Protein Lysate
MBS8419119-01 0.02 mg

Human SCNN1B Protein Lysate

Sign In for Pricing
View Details
Human SCNN1B Protein Lysate
MBS8419119-02 5x 0.02 mg

Human SCNN1B Protein Lysate

Sign In for Pricing
View Details
Glutathione and Oxidazed Glutathione Quantification
KB03039-100 100 Tests

Glutathione and Oxidazed Glutathione Quantification

Sign In for Pricing
View Details
IL-3/IL-5/GM-CSFRβ siRNA (m)
sc-35659 10 µM

IL-3/IL-5/GM-CSFRβ siRNA (m)

Sign In for Pricing
View Details
Goat Japanese Encephalitis IgG,JE IgG ELISA KIT
JOT-EKD0010GO 96 wells

Goat Japanese Encephalitis IgG,JE IgG ELISA KIT

Sign In for Pricing
View Details