Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICOS Recombinant Protein (Rat)

Product Specifications

CAS Number

9000-83-3

Gene Name

Inducible T-cell co-stimulator

Gene Aliases

Activation-inducible lymphocyte immunomediatory molecule; Ailim; inducible T-cell costimulator.

Gene ID

64545

Accession Number

NP_072132

Reactivity

Rat|Rattus norvegicus

Target

Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes (By similarity) .

Type

Protein

Source

E.coli

Sequence

ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKLWLP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Icos

Protein Name

Inducible T-cell costimulator

Gene Name URL

Icos

Nucleotide Accession Number

NM_022610

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUBP2 Antibody
MBS8503126-01 0.1 mg

NUBP2 Antibody

Sign In for Pricing
View Details
NUBP2 Antibody
MBS8503126-02 0.1 mL (AF405L)

NUBP2 Antibody

Sign In for Pricing
View Details
NUBP2 Antibody
MBS8503126-03 0.1 mL (AF405S)

NUBP2 Antibody

Sign In for Pricing
View Details
NUBP2 Antibody
MBS8503126-04 0.1 mL (AF610)

NUBP2 Antibody

Sign In for Pricing
View Details
NUBP2 Antibody
MBS8503126-05 0.1 mL (AF635)

NUBP2 Antibody

Sign In for Pricing
View Details
NUBP2 Antibody
MBS8503126-06 0.1 mL (APC)

NUBP2 Antibody

Sign In for Pricing
View Details