Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBPE Recombinant Protein (Bacillus subtilis)

Product Specifications

CAS Number

9000-83-3

Gene Name

Penicillin-binding protein 4*

Gene Aliases

BSU_34440; BSU34440; PBP 4A; penicillin-binding protein 4*; Penicillin-binding protein E.

Gene ID

938615

Reactivity

Bacillus subtilis

Target

Probably involved in peptidoglycan modification during cortex synthesis.

Type

Protein

Source

E.coli

Sequence

MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

67.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PbpE

Protein Name

Penicillin-binding protein 4*

Gene Name URL

PbpE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey soluble OX40 Ligand ELISA Kit
MBS7217326-01 48 Well

Monkey soluble OX40 Ligand ELISA Kit

Sign In for Pricing
View Details
Monkey soluble OX40 Ligand ELISA Kit
MBS7217326-02 96 Well

Monkey soluble OX40 Ligand ELISA Kit

Sign In for Pricing
View Details
Monkey soluble OX40 Ligand ELISA Kit
MBS7217326-03 5x 96 Well

Monkey soluble OX40 Ligand ELISA Kit

Sign In for Pricing
View Details
Monkey soluble OX40 Ligand ELISA Kit
MBS7217326-04 10x 96 Well

Monkey soluble OX40 Ligand ELISA Kit

Sign In for Pricing
View Details
Sheep Glycated hemoglobin A1c ELISA kit
GTR10416482 96 Well

Sheep Glycated hemoglobin A1c ELISA kit

Sign In for Pricing
View Details
HOXC12 Human shRNA Lentiviral Particle (Locus ID 3228)
TL316584V 500 µL Each

HOXC12 Human shRNA Lentiviral Particle (Locus ID 3228)

Sign In for Pricing
View Details