Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBPE Recombinant Protein (Bacillus subtilis)

Product Specifications

CAS Number

9000-83-3

Gene Name

Penicillin-binding protein 4*

Gene Aliases

BSU_34440; BSU34440; PBP 4A; penicillin-binding protein 4*; Penicillin-binding protein E.

Gene ID

938615

Reactivity

Bacillus subtilis

Target

Probably involved in peptidoglycan modification during cortex synthesis.

Type

Protein

Source

E.coli

Sequence

MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

67.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PbpE

Protein Name

Penicillin-binding protein 4*

Gene Name URL

PbpE

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAKγ Polyclonal Antibody
RA28499-01 50 µL

PAKγ Polyclonal Antibody

Sign In for Pricing
View Details
PAKγ Polyclonal Antibody
RA28499-02 100 µL

PAKγ Polyclonal Antibody

Sign In for Pricing
View Details
RPS6KA1 (RPS6KA1, MAPKAPK1A, RSK1, Ribosomal protein S6 kinase alpha-1, 90kD ribosomal protein S6 kinase 1, MAP kinase-activated protein kinase 1a, Ribosomal S6 kinase 1) (AP) discontinued
031222-AP 200 µL

RPS6KA1 (RPS6KA1, MAPKAPK1A, RSK1, Ribosomal protein S6 kinase alpha-1, 90kD ribosomal protein S6 kinase 1, MAP kinase-activated protein kinase 1a, Ribosomal S6 kinase 1) (AP) discontinued

Sign In for Pricing
View Details
Horse Glutathione S-transferase Mu 1 ELISA Kit
MBS017092-01 48 Well

Horse Glutathione S-transferase Mu 1 ELISA Kit

Sign In for Pricing
View Details
Horse Glutathione S-transferase Mu 1 ELISA Kit
MBS017092-02 96 Well

Horse Glutathione S-transferase Mu 1 ELISA Kit

Sign In for Pricing
View Details
Horse Glutathione S-transferase Mu 1 ELISA Kit
MBS017092-03 5x 96 Well

Horse Glutathione S-transferase Mu 1 ELISA Kit

Sign In for Pricing
View Details