Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGLL Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Monoglyceride lipase

Gene Aliases

AA589436; Ma; Magl; Mgl; monoacylglycerol lipase; monoglyceride lipase.

Gene ID

23945

Accession Number

NP_001159721

Reactivity

Mouse|Mus musculus

Target

Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (PubMed:9341166, PubMed:17700715, PubMed:18096503, PubMed:19029917, PubMed:20729846) . Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth (By similarity) .

Type

Protein

Source

Yeast

Sequence

MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Mgll

Protein Name

Monoglyceride lipase

Gene Name URL

Mgll

Nucleotide Accession Number

NM_001166249

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1056164-01 0.02 mg (E-Coli)

Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1056164-02 0.02 mg (Yeast)

Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1056164-03 0.1 mg (E-Coli)

Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1056164-04 0.1 mg (Yeast)

Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1056164-05 0.02 mg (Baculovirus)

Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1056164-06 0.02 mg (Mammalian-Cell)

Recombinant Salmonella heidelberg Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details