Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3G Recombinant Protein (Cynomolgus monkey)

Product Specifications

CAS Number

9000-83-3

Gene Name

CD3g molecule

Gene Aliases

CD3 gamma; CD3g molecule, epsilon (CD3-TCR complex) ; CD3g molecule, gamma (CD3-TCR complex) ; T-cell receptor T3 gamma chain; T-cell surface glycoprotein CD3 gamma chain.

Gene ID

102134381

Reactivity

Cynomolgus Monkey|Macaca fascicularis

Target

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.

Type

Protein

Source

Yeast

Sequence

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

12.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CD3G

Protein Name

T-cell surface glycoprotein CD3 gamma chain

Gene Name URL

CD3G

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)
MBS2035342-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)
MBS2035342-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)
MBS2035342-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)
MBS2035342-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)
MBS2035342-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)
MBS2035342-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Erythropoietin Receptor (EPOR)

Sign In for Pricing
View Details