Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF11 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ring finger protein 11

Gene Aliases

CGI-123; RING finger protein 11; SID1669.

Gene ID

26994

Accession Number

NP_055187

Reactivity

Homo sapiens|Human

Target

Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome.

Type

Protein

Source

Yeast

Sequence

GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RNF11

Protein Name

RING finger protein 11

Gene Name URL

RNF11

Nucleotide Accession Number

NM_014372

More Discoveries

Explore Other Products

Browse additional items from our catalog

Onerack 16mm tubes Yellow
STA5042 1 Each

Onerack 16mm tubes Yellow

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Universal stress protein B (uspB), partial
MBS7068122 Inquire

Recombinant Escherichia coli O17:K52:H18 Universal stress protein B (uspB), partial

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1255701-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1255701-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O17:K52:H18 Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1255701-03 0.02 mg (Yeast)

Recombinant Escherichia coli O17:K52:H18 Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details
Recombinant Escherichia coli O17:K52:H18 Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1255701-04 0.1 mg (Yeast)

Recombinant Escherichia coli O17:K52:H18 Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details