Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PETE Recombinant Protein (Prochlorothrix hollandica)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

PetE, Plastocyanin

Reactivity

Prochlorothrix hollandica

Target

Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.

Type

Protein

Source

E.coli

Sequence

ATVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PETE

Protein Name

Plastocyanin

Gene Name URL

PETE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tomm6 (NM_001164729) Mouse Tagged ORF Clone
MG225150 10 µg

Tomm6 (NM_001164729) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)
MBS2116273-01 0.1 mL

HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)
MBS2116273-02 0.2 mL

HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)
MBS2116273-03 0.5 mL

HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)
MBS2116273-04 1 mL

HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)
MBS2116273-05 5 mL

HRP-Linked Polyclonal Antibody to Indoleamine-2,3-Dioxygenase 2 (IDO2)

Sign In for Pricing
View Details