Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFP2 Recombinant Protein (Radish)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Cysteine-rich antifungal protein 2.

Reactivity

Radish|Raphanus sativus

Target

Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K (+) efflux and Ca (2+) uptake.

Type

Protein

Source

E.coli

Sequence

QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AFP2

Protein Name

Defensin-like protein 2

Gene Name URL

AFP2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

βB1-crystallin (A-8)
sc-374496 200 µg/mL

βB1-crystallin (A-8)

Sign In for Pricing
View Details
GPR22 3'UTR Luciferase Stable Cell Line
TU009151 1.0 mL

GPR22 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
EZH2 (Y641F) Chemiluminescent Assay Kit
52075 96 Reactions

EZH2 (Y641F) Chemiluminescent Assay Kit

Sign In for Pricing
View Details
(AP) Polymer anti-Mouse, 1.000 tests
orb1087572 1 Unit

(AP) Polymer anti-Mouse, 1.000 tests

Sign In for Pricing
View Details
MuSK (Muscle Skeletal Receptor Tyrosine Kinase, MGC126323, MGC126324, Muscle Specific Kinase Receptor, Muscle Specific Tyrosine Protein Kinase Receptor, Receptor Tyrosine Kinase MuSK, Skeletal Muscle Receptor Tyrosine Kinase) (HRP) discontinued
M9530-01B-HRP 200 µL

MuSK (Muscle Skeletal Receptor Tyrosine Kinase, MGC126323, MGC126324, Muscle Specific Kinase Receptor, Muscle Specific Tyrosine Protein Kinase Receptor, Receptor Tyrosine Kinase MuSK, Skeletal Muscle Receptor Tyrosine Kinase) (HRP) discontinued

Sign In for Pricing
View Details
Smad7 Double Nickase Plasmid (m2)
sc-421530-NIC-2 20 µg

Smad7 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details