Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLI2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

GLI family zinc finger 2

Gene Aliases

CJS; GLI family zinc finger protein 2; GLI-Kruppel family member GLI2; glioma-associated oncogene family zinc finger 2; HPE9; oncogene GLI2; PHS2; Tax helper protein; tax helper protein 1; tax helper protein 2; tax-responsive element-2 holding protein; tax-responsive element-25-bp sequence binding protein; THP1; THP2; zinc finger protein GLI2.

Gene ID

2736

Accession Number

NP_005261

Reactivity

Homo sapiens|Human

Target

Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992, PubMed:26565916) . Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597) . May also function as transcriptional repressor (By similarity) . Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856) .

Type

Protein

Source

E.coli

Sequence

EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GLI2

Protein Name

Zinc finger protein GLI2

Gene Name URL

GLI2

Nucleotide Accession Number

NM_005270

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Protein FAR1-RELATED SEQUENCE 4 (FRS4) , partial
MBS1291999 Inquire

Recombinant Arabidopsis thaliana Protein FAR1-RELATED SEQUENCE 4 (FRS4) , partial

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2096679-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2096679-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2096679-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2096679-04 1 mL

Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)
MBS2096679-05 5 mL

Biotin-Linked Polyclonal Antibody to Non Metastatic Cells 1, Protein NM23A Expressed In (NME1)

Sign In for Pricing
View Details