Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AFP Recombinant Protein (Aspergillus giganteus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

AfpAntifungal protein

Reactivity

Aspergillus giganteus

Target

This protein inhibits the growth of a variety of fungal species.

Type

Protein

Source

E.coli

Sequence

ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AFP

Protein Name

Antifungal protein

Gene Name URL

AFP

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sf3b3 (NM_133953) Mouse Tagged ORF Clone Lentiviral Particle
MR211816L3V 200 µL

Sf3b3 (NM_133953) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Strawberry crinkle virus
Oneq-A568-100R 100 Reactions

Strawberry crinkle virus

Sign In for Pricing
View Details
Human Zinc finger and BTB domain-containing protein 46 (ZBTB46) ELISA Kit
abx384370 96 Tests

Human Zinc finger and BTB domain-containing protein 46 (ZBTB46) ELISA Kit

Sign In for Pricing
View Details
Horse Nuclear Transcription Factor Y Subunit Alpha (NFYA) ELISA Kit
MBS9943954-01 48 Well

Horse Nuclear Transcription Factor Y Subunit Alpha (NFYA) ELISA Kit

Sign In for Pricing
View Details
Horse Nuclear Transcription Factor Y Subunit Alpha (NFYA) ELISA Kit
MBS9943954-02 96 Well

Horse Nuclear Transcription Factor Y Subunit Alpha (NFYA) ELISA Kit

Sign In for Pricing
View Details
Horse Nuclear Transcription Factor Y Subunit Alpha (NFYA) ELISA Kit
MBS9943954-03 5x 96 Well

Horse Nuclear Transcription Factor Y Subunit Alpha (NFYA) ELISA Kit

Sign In for Pricing
View Details