Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PVR Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

PVR cell adhesion molecule

Gene Aliases

CD155; HVED; Necl-5; NECL5; nectin-like protein 5; poliovirus receptor; PVS; TAGE4.

Gene ID

5817

Accession Number

NP_001129240

Reactivity

Homo sapiens|Human

Target

Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration.

Type

Protein

Source

E.coli

Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

51.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PVR

Protein Name

Poliovirus receptor

Gene Name URL

PVR

Nucleotide Accession Number

NM_001135768

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC43A1 Antibody
MBS7117038-01 0.05 mg

SLC43A1 Antibody

Sign In for Pricing
View Details
SLC43A1 Antibody
MBS7117038-02 0.1 mg

SLC43A1 Antibody

Sign In for Pricing
View Details
SLC43A1 Antibody
MBS7117038-03 5x 0.1 mg

SLC43A1 Antibody

Sign In for Pricing
View Details
Guan-fu base H
M38938-01 100 mg

Guan-fu base H

Sign In for Pricing
View Details
Guan-fu base H
M38938-02 50 mg

Guan-fu base H

Sign In for Pricing
View Details
Guan-fu base H
M38938-03 500 mg

Guan-fu base H

Sign In for Pricing
View Details