Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aed a Recombinant Protein (Yellowfever mosquito)

Product Specifications

CAS Number

9000-83-3

Gene Name

37 kDa salivary gland allergen Aed a 2

Gene Aliases

37 kDa salivary gland allergen Aed a 2; AaeL_AAEL006424; AAEL006424; ALL2_AEDAE; D7; Protein D7.

Gene ID

5567958

Reactivity

Aedes aegypti

Target

Thought to be involved in blood-feeding.

Type

Protein

Source

E.coli

Sequence

STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LOC5567958

Protein Name

37 kDa salivary gland allergen Aed a 2

Gene Name URL

LOC5567958

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Chloro-2- (chloromethyl) -4-phenyl-quinazoline
006009 100 mg

6-Chloro-2- (chloromethyl) -4-phenyl-quinazoline

Sign In for Pricing
View Details
Histone H3, Tri-methylated (K10) discontinued
537404-01 30ul

Histone H3, Tri-methylated (K10) discontinued

Sign In for Pricing
View Details
Histone H3, Tri-methylated (K10) discontinued
537404-02 100 µL

Histone H3, Tri-methylated (K10) discontinued

Sign In for Pricing
View Details
Human Connexin 26 (CX26) ELISA Kit
DLR-CX26-Hu-48T 48 Tests

Human Connexin 26 (CX26) ELISA Kit

Sign In for Pricing
View Details
C9orf86 (RABL6) (NM_024718) Human Recombinant Protein
E45H39181M5 20 µg

C9orf86 (RABL6) (NM_024718) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human ZFX sgRNA gene knockout kit - Lentiviral human ZFX sgRNA gene knockout kit (25)
GTR15354884 1 Vial

Lentiviral human ZFX sgRNA gene knockout kit - Lentiviral human ZFX sgRNA gene knockout kit (25)

Sign In for Pricing
View Details