What is the catalog number for IZUMO1R Recombinant Protein (Human)?

The catalog number for IZUMO1R Recombinant Protein (Human) is OPCA04382-100UG.

What sizes are available for IZUMO1R Recombinant Protein (Human)?

IZUMO1R Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is IZUMO1R Recombinant Protein (Human) in stock?

IZUMO1R Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

IZUMO1R Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

IZUMO1 receptor, JUNO

Gene Aliases

Folate receptor 4; folate receptor 4 (delta) homolog; folate receptor 4, delta (putative) ; folate receptor delta; Folbp3; FOLR4; FR-delta; IZUMO1 receptor protein JUNO; IZUMO1 receptor, JUNO, FR-delta; JUNO; probable folate receptor delta; sperm-egg fusion protein Juno.

Gene ID

390243

Accession Number

NP_001186135

Reactivity

Homo sapiens|Human

Target

Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for species-specific gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Does not bind folate.

Type

Protein

Source

E.coli

Sequence

GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.