Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC4C Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-type lectin domain family 4 member C

Gene Aliases

BDCA2; BDCA-2; Blood dendritic cell antigen 2; blood dendritic cell antigen 2 protein; CD303; CLECSF11; CLECSF7; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 11; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 7; C-type lectin domain family 4 member C; C-type lectin superfamily member 7; dendritic cell lectin b; dendritic lectin; DLEC; HECL; PRO34150.

Gene ID

170482

Accession Number

NP_569708

Reactivity

Homo sapiens|Human

Target

Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells (PubMed:11748283, PubMed:21880719, PubMed:25995448) . Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal (beta1-3/4) GlcNAc (beta1-2) Man (PubMed:21880719, PubMed:25995448) . Binds to serum IgG (PubMed:25995448) . Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells (PubMed:11748283) . May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells (PubMed:11748283, PubMed:21880719) . May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium (PubMed:11748283) .

Type

Protein

Source

Yeast

Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22 kda

Protein Length

Recombinant

NCBI Gene Symbol

CLEC4C

Protein Name

C-type lectin domain family 4 member C

Gene Name URL

CLEC4C

Nucleotide Accession Number

NM_130441

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDH19 (Cadherin-19, CDH7L2, UNQ478/PRO941) (PE)
124770-PE 100 µL

CDH19 (Cadherin-19, CDH7L2, UNQ478/PRO941) (PE)

Sign In for Pricing
View Details
DeBox LSHL 220.3 x 157 x 87 mm
B11583 5/Pack

DeBox LSHL 220.3 x 157 x 87 mm

Sign In for Pricing
View Details
Tmpo (NM_001283048) Mouse Untagged Clone
MC225654 10 µg

Tmpo (NM_001283048) Mouse Untagged Clone

Sign In for Pricing
View Details
NEU4 Rabbit Polyclonal Antibody
orb629248-01 50 µg

NEU4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NEU4 Rabbit Polyclonal Antibody
orb629248-02 100 µg

NEU4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LIN54 Protein Vector (Rat) (pPB-C-His)
PV277634 500 ng

LIN54 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details