What is the catalog number for AKAP4 Recombinant Protein (Human)?

The catalog number for AKAP4 Recombinant Protein (Human) is OPCA04352-100UG.

What sizes are available for AKAP4 Recombinant Protein (Human)?

AKAP4 Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is AKAP4 Recombinant Protein (Human) in stock?

AKAP4 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

AKAP4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

A-kinase anchoring protein 4

Gene Aliases

A kinase (PRKA) anchor protein 4; AKAP 82; AKAP-4; AKAP82; A-kinase anchor protein 4; A-kinase anchor protein 82 kDa; cancer/testis antigen 99; CT99; epididymis secretory sperm binding protein; FSC1; hAKAP82; HI; major sperm fibrous sheath protein; p82; PRKA4; protein kinase A anchoring protein 4; Protein kinase A-anchoring protein 4; testis-specific gene HI.

Gene ID

8852

Accession Number

NP_003877

Reactivity

Homo sapiens|Human

Target

Major structural component of sperm fibrous sheath. Plays a role in sperm motility.

Type

Protein

Source

E.coli

Sequence

QSPSAPPAKPPSTQRAVISPDGECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVELTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQVASDMMVSLMKTLKVHSSGKPIPASVVLKRVLLRHTKEIVSDLIDSCMKNLHNITGVLMTDSDFVSAVKRNLFNQWKQNATDIMEAMLKRLVSALIGEEKETKSQSLSYASLKAGSHDPKCRNQSLEFSTMKAEMKERDKGKMKSDPCKSLTSAEKVGEHILKEGLTIWNQKQGNSCKVATKACSNKDEKGEKINASTDSLAKDLIVSALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQANGQFIDKLVESVMKLCLIMAKYSNDGAALAELEEQAASANKPNFRGTRCIHSGAMPQNYQDSLGHEVIVNNQCSTNSLQKQLQAVLQWIAASQFNVPMLYFMGDKDGQLEKLPQVSAKAAEKGYSVGGLLQEVMKFAKERQPDEAVGKVARKQLLDWLLANL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.