Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LCN5 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Lipocalin 5

Gene Aliases

Epididymal retinoic acid binding protein; Epididymal retinoic acid-binding protein; epididymal secretory protein 10; epididymal-specific lipocalin-5; Er; Erabp; E-RABP; MEP1; MEP10; mE-R.

Gene ID

13863

Accession Number

NP_001036095

Reactivity

Mouse|Mus musculus

Target

Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation.

Type

Protein

Source

E.coli

Sequence

TEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Lcn5

Protein Name

Epididymal-specific lipocalin-5

Gene Name URL

Lcn5

Nucleotide Accession Number

NM_001042630

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL13AP2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV776529 1.0 µg DNA

RPL13AP2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CD35 (CR1, C3 binding protein, C3b/C4b receptor, C3BR, C4BR, Complement Component (3b/4b) receptor 1 including Knops blood group system, Complement receptor type 1, KN, Knops blood group antigen) (MaxLight 405) discontinued
138513-AF-ML405 100 µL

CD35 (CR1, C3 binding protein, C3b/C4b receptor, C3BR, C4BR, Complement Component (3b/4b) receptor 1 including Knops blood group system, Complement receptor type 1, KN, Knops blood group antigen) (MaxLight 405) discontinued

Sign In for Pricing
View Details
S1P (MBTPS1) (NM_003791) Human Tagged Lenti ORF Clone
RC212265L3 10 µg

S1P (MBTPS1) (NM_003791) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Adh5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K5029606 1.0 µg DNA

Adh5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
DPM2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0627708 1.0 µg DNA

DPM2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GART antibody - middle region (ARP45755_P050)
ARP45755_P050 100 µL

GART antibody - middle region (ARP45755_P050)

Sign In for Pricing
View Details