Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCA4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4

Gene Aliases

ATP-dependent helicase SMARCA4; BAF190; BAF190A; brahma protein-like 1; BRG1; BRG1-associated factor 190A; BRM/SWI2-related gene 1; CSS4; global transcription activator homologous sequence; homeotic gene regulator; hSNF2b; mitotic growth and transcription activator; MRD16; nuclear protein GRB1; protein brahma homolog 1; protein BRG-1; RTPS2; SNF2; SNF2-beta; SNF2L4; SNF2LB; SNF2-like 4; sucrose nonfermenting-like 4; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4; SWI2; transcription activator BRG1.

Gene ID

6597

Accession Number

NP_001122316

Reactivity

Homo sapiens|Human

Target

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology) . Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating the calcium-dependent release of a repressor complex and the recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by SMARCA4-dependent recruitment of a phospho-RB1-HDAC repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves the release of HDAC1 and recruitment of CREBBP. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex) . During neural development, a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF) . The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. SMARCA4/BAF190A may promote neural stem cell self-renewal/proliferation by enhancing Notch-dependent proliferative signals, while concurrently making the neural stem cell insensitive to SHH-dependent differentiating cues (By similarity) . Acts as a corepressor of ZEB1 to regulate E-cadherin transcription and is required for induction of epithelial-mesenchymal transition (EMT) by ZEB1. Binds via DLX1 to enhancers located in the intergenic region between DLX5 and DLX6 and this binding is stabilized by the long non-coding RNA (lncRNA) Evf2 (By similarity) . Binds to RNA in a promiscuous manner (By similarity) . Binding to RNAs including lncRNA Evf2 leads to inhibition of SMARCA4 ATPase and chromatin remodeling activities (By similarity) .

Type

Protein

Source

E.coli

Sequence

IIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SMARCA4

Protein Name

Transcription activator BRG1

Gene Name URL

SMARCA4

Nucleotide Accession Number

NM_001128844

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Intermedin-53 (Human) - Purified IgG Antibody
G-010-60 200 µg

Intermedin-53 (Human) - Purified IgG Antibody

Sign In for Pricing
View Details
Phospho-TIF1 beta (Ser824) Antibody
AF8352-01 100 µL

Phospho-TIF1 beta (Ser824) Antibody

Sign In for Pricing
View Details
Phospho-TIF1 beta (Ser824) Antibody
AF8352-02 200 µL

Phospho-TIF1 beta (Ser824) Antibody

Sign In for Pricing
View Details
CSTA/Cystatin A Antibody
orb1537551 50 μL

CSTA/Cystatin A Antibody

Sign In for Pricing
View Details
GPR4 (NM_005282) Human Tagged ORF Clone Lentiviral Particle
RC209686L2V 200 µL

GPR4 (NM_005282) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral mouse Atp5mpl shRNA (UAS) - Lentiviral mouse Atp5mpl shRNA (UAS, RFP) (25)
GTR15302798 1 Vial

Lentiviral mouse Atp5mpl shRNA (UAS) - Lentiviral mouse Atp5mpl shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details