Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLUL Recombinant Protein (Cricetulus barabensis griseus)

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutamate-ammonia ligase (glutamine synthetase)

Gene Aliases

Glul; Glutamate decarboxylase; Glutamate--ammonia ligase; glutamine synthetase; GS; I79_011499; palmitoyltransferase GLUL.

Gene ID

100689337

Accession Number

NP_001233699

Reactivity

Chinese Hamster|Cricetulus griseus

Target

Essential for proliferation of fetal skin fibroblasts. This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner (By similarity) .

Type

Protein

Source

E.coli

Sequence

ATSASSHLNKGIKQMYMSLPQGEKVQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQSESSNSDMYLSPVAMFRDPFRKEPNKLVFCEVFKYNQKPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLLGTDGHPFGWPSDGFPGPQGLYYCGVGADKAYRRDIMEAHYRACLYAGVKITGTYAEVKHAQWEFQIGPCEGIRMGDHLWVARFILHRVCKDFGVIATFDSKPIPGNWNGAGCHTNFSTKTMREENGLKHIKEAIEKLSKRHRYHIRAYDPKGGLDNARRLTGFHKTSNINDFSAGVADRSASIRIPRTVGQEKKGYFEARCPSANCDPFAVTEAIVRTCLLNETGDQPFQYKN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LOC100689337

Protein Name

Glutamine synthetase

Gene Name URL

LOC100689337

Nucleotide Accession Number

NM_001246770

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (MaxLight 650)
MBS6223068-01 0.1 mL

MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (MaxLight 650)

Sign In for Pricing
View Details
MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (MaxLight 650)
MBS6223068-02 5x 0.1 mL

MAGEA3 (Melanoma-associated Antigen 3, Antigen MZ2-D, Cancer/Testis Antigen 1.3, CT1.3, MAGE-3 Antigen, MAGE3, MGC14613) (MaxLight 650)

Sign In for Pricing
View Details
FAM154B ORF Vector (Human) (pORF)
ORF019177 1.0 µg DNA

FAM154B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ABHD14B Antibody
orb674840-01 50 µg

ABHD14B Antibody

Sign In for Pricing
View Details
ABHD14B Antibody
orb674840-02 100 µg

ABHD14B Antibody

Sign In for Pricing
View Details
OriCell™ Exosomes Extraction Kit For Cell Culture Supernatant
EEKC-10001-100 100 mL

OriCell™ Exosomes Extraction Kit For Cell Culture Supernatant

Sign In for Pricing
View Details