What is the catalog number for NAT2 Recombinant Protein (Human)?

The catalog number for NAT2 Recombinant Protein (Human) is OPCA04333-100UG.

What sizes are available for NAT2 Recombinant Protein (Human)?

NAT2 Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is NAT2 Recombinant Protein (Human) in stock?

NAT2 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

NAT2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

N-acetyltransferase 2

Gene Aliases

AAC2; arylamide acetylase 2; arylamine N-acetyltransferase 2; N-acetyltransferase 2 (arylamine N-acetyltransferase) ; N-acetyltransferase type 2; NAT-2; PNAT; Polymorphic arylamine N-acetyltransferase.

Gene ID

Accession Number

NP_000006

Reactivity

Homo sapiens|Human

Target

Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.

Type

Protein

Source

E.coli

Sequence

MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.