Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RETNLB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Resistin like beta

Gene Aliases

C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 2; colon and small intestine-specific cysteine-rich protein; colon carcinoma-related gene protein; cysteine-rich secreted A12-alpha-like protein 1; cysteine-rich secreted protein A12-alpha-like 1; cysteine-rich secreted protein FIZZ2; FIZZ1; FIZZ2; found in inflammatory zone 1; HXCP2; RELMb; RELMbeta; RELM-beta; resistin-like beta; XCP2.

Gene ID

84666

Accession Number

NP_115968

Reactivity

Homo sapiens|Human

Target

Probable hormone.

Type

Protein

Source

E.coli

Sequence

QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RETNLB

Protein Name

Resistin-like beta

Gene Name URL

RETNLB

Nucleotide Accession Number

NM_032579

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal LPAR3 / LPA3 / EDG7 Antibody (Cytoplasmic Domain)
AMM06328G 0.05mg

Polyclonal LPAR3 / LPA3 / EDG7 Antibody (Cytoplasmic Domain)

Sign In for Pricing
View Details
Ntm Rat shRNA Lentiviral Particle (Locus ID 50864)
TL710137V 500 µL Each

Ntm Rat shRNA Lentiviral Particle (Locus ID 50864)

Sign In for Pricing
View Details
ARPC5 Recombinant Monoclonal Antibody
RAC08259-01 50 µL

ARPC5 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
ARPC5 Recombinant Monoclonal Antibody
RAC08259-02 100 µL

ARPC5 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Acholeplasma laidlawii Thymidylate synthase (thyA)
MBS1207689-01 0.02 mg (Yeast)

Recombinant Acholeplasma laidlawii Thymidylate synthase (thyA)

Sign In for Pricing
View Details
Recombinant Acholeplasma laidlawii Thymidylate synthase (thyA)
MBS1207689-02 0.1 mg (Yeast)

Recombinant Acholeplasma laidlawii Thymidylate synthase (thyA)

Sign In for Pricing
View Details