Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGIRR Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Single immunoglobulin and toll-interleukin 1 receptor (TIR) domain

Gene Aliases

AI256711; S; single Ig IL-1 receptor related protein; single Ig IL-1-related receptor; single Ig IL-1R-related molecule; single Ig IL-1R-related protein; single immunoglobulin domain-containing IL1R-related protein; Ti; TIR8; toll/interleukin-1 receptor 8.

Gene ID

24058

Reactivity

Mouse|Mus musculus

Target

Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP (By similarity) .

Type

Protein

Source

Yeast

Sequence

MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

14.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Sigirr

Protein Name

Single Ig IL-1-related receptor

Gene Name URL

Sigirr

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Candida Albicans BET2 Protein (aa 1-341)
VAng-Lsx05339-50gEcoli 50 µg (E. coli)

Recombinant Candida Albicans BET2 Protein (aa 1-341)

Sign In for Pricing
View Details
Anti-Calponin 3/CNN3 Antibody Picoband®, PE Conjugate
A08267-3-PE 100 µg/Vial

Anti-Calponin 3/CNN3 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
IKZF1 Recombinant Monoclonal Antibody
MBS9019322-01 0.05 mL

IKZF1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
IKZF1 Recombinant Monoclonal Antibody
MBS9019322-02 0.1 mL

IKZF1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
IKZF1 Recombinant Monoclonal Antibody
MBS9019322-03 5x 0.1 mL

IKZF1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Anti-Human CD8-SPRD
MBS670229-01 100 Tests

Mouse Anti-Human CD8-SPRD

Sign In for Pricing
View Details