Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AVPR2 Recombinant Protein (Pig)

Product Specifications

CAS Number

9000-83-3

Gene Name

Vasopressin receptor 2

Gene Aliases

Antidiuretic hormone receptor; arginine vasopressin receptor 2 (nephrogenic diabetes insipidus) ; AVPR V2; renal-type arginine vasopressin receptor; V-2 lysine vasopressin receptor; V2R; vasopressin V2 receptor.

Gene ID

397462

Accession Number

NP_999397

Reactivity

Porcine|Sus scrofa

Target

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786) . Involved in renal water reabsorption (By similarity) .

Type

Protein

Source

E.coli

Sequence

WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

24.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

AVPR2

Protein Name

Vasopressin V2 receptor

Gene Name URL

AVPR2

Nucleotide Accession Number

NM_214232

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Putative zinc finger protein 355P (ZNF355P) Human ELISA Kit
G5793 96 Tests

Putative zinc finger protein 355P (ZNF355P) Human ELISA Kit

Sign In for Pricing
View Details
Methylmalonic acid 1g
A19225-1000 1000 mg

Methylmalonic acid 1g

Sign In for Pricing
View Details
ZIP Kinase Rabbit Polyclonal Antibody (PerCP)
orb2495122 100 µL

ZIP Kinase Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Human IL-28A Matched Antibody Pair Set [ABP-S-02600]
ABP-S-02600 5 Plates

Human IL-28A Matched Antibody Pair Set [ABP-S-02600]

Sign In for Pricing
View Details
Guinea Pig B box and SPRY domain containing protein (BSPRY) ELISA Kit
GTR10349405 96 Well

Guinea Pig B box and SPRY domain containing protein (BSPRY) ELISA Kit

Sign In for Pricing
View Details
3,6’-disinapoyl sucrose
AB1581 20 mg

3,6’-disinapoyl sucrose

Sign In for Pricing
View Details