Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UOX Recombinant Protein (Pig)

Product Specifications

CAS Number

9000-83-3

Gene Name

Urate oxidase

Gene Aliases

Urate oxidase; uricase.

Gene ID

397510

Reactivity

Porcine|Sus scrofa

Target

Catalyzes the oxidation of uric acid to 5-hydroxyisourate, which is further processed to form (S) -allantoin.

Type

Protein

Source

E.coli

Sequence

MAHYRNDYKKNDEVEFVRTGYGKDMIKVLHIQRDGKYHSIKEVATSVQLTLSSKKDYLHGDNSDVIPTDTIKNTVNVLAKFKGIKSIETFAVTICEHFLSSFKHVIRAQVYVEEVPWKRFEKNGVKHVHAFIYTPTGTHFCEVEQIRNGPPVIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYHQGRDVDFEATWDTVRSIVLQKFAGPYDKGEYSPSVQKTLYDIQVLTLGQVPEIEDMEISLPNIHYLNIDMSKMGLINKEEVLLPLDNPYGRITGTVKRKLTSRL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

51 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UOX

Protein Name

Uricase

Gene Name URL

UOX

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpd2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
22460114 3x 1.0 µg

Gpd2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Rat Pannexin-3 (Panx3), partial
MBS7112202 Inquire

Recombinant Rat Pannexin-3 (Panx3), partial

Sign In for Pricing
View Details
Rat Lamin B Ready-To-Use IHC Kit
IHC0183R 50 Tests

Rat Lamin B Ready-To-Use IHC Kit

Sign In for Pricing
View Details
UPF2, ID (UPF2, KIAA1408, RENT2, Regulator of nonsense transcripts 2, Nonsense mRNA reducing factor 2, Up-frameshift suppressor 2 homolog) (AP)
MBS6361608-01 0.2 mL

UPF2, ID (UPF2, KIAA1408, RENT2, Regulator of nonsense transcripts 2, Nonsense mRNA reducing factor 2, Up-frameshift suppressor 2 homolog) (AP)

Sign In for Pricing
View Details
UPF2, ID (UPF2, KIAA1408, RENT2, Regulator of nonsense transcripts 2, Nonsense mRNA reducing factor 2, Up-frameshift suppressor 2 homolog) (AP)
MBS6361608-02 5x 0.2 mL

UPF2, ID (UPF2, KIAA1408, RENT2, Regulator of nonsense transcripts 2, Nonsense mRNA reducing factor 2, Up-frameshift suppressor 2 homolog) (AP)

Sign In for Pricing
View Details
Recombinant Human TNFSF8 Protein (S83A), His-tagged
TNFSF8-22H 10 µg

Recombinant Human TNFSF8 Protein (S83A), His-tagged

Sign In for Pricing
View Details