What is the catalog number for T4 Lysozyme Recombinant Protein (Bacteriophage T4)?

The catalog number for T4 Lysozyme Recombinant Protein (Bacteriophage T4) is OPCA04293-1MG.

What sizes are available for T4 Lysozyme Recombinant Protein (Bacteriophage T4)?

T4 Lysozyme Recombinant Protein (Bacteriophage T4) is available in the following size(s): 1 mg.

Is T4 Lysozyme Recombinant Protein (Bacteriophage T4) in stock?

T4 Lysozyme Recombinant Protein (Bacteriophage T4) is currently made to order / not held in immediate stock. Contact us for lead time.

T4 Lysozyme Recombinant Protein (Bacteriophage T4)

Product Specifications

CAS Number

9000-83-3

Gene Name

E Lysozyme murein hydrolase

Gene Aliases

E Lysozyme murein hydrolase; Lysis protein; Lysozyme; Muramidase; T4p123.

Gene ID

1258585

Accession Number

NP_049736

Reactivity

Enterobacteria phage T4|Escherichia phage T4

Target

Endolysin with lysozyme activity that degrades host peptidoglycans and participates with the holin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and break down the peptidoglycan layer.

Type

Protein

Source

E.coli

Sequence

MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.